[Ala2,8,9,11,19,22,24,25,27,28]-VIP_product_DataBase

CAS: 866552-34-3 F: C131H219N41O33S W: 2928.46

-VIP is an analog vasoactive intestinal polypeptide (VIP) with high affinity and selectivity for human VIP/pituitary ade

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity	[Ala2,8,9,11,19,22,24,25,27,28]-VIP is an analog vasoactive intestinal polypeptide (VIP) with high affinity and selectivity for human VIP/pituitary adenylate cyclase-activating polypeptide 1 (hVPAC1). VIP is a widespread neurotransmitter[1].
CAS	866552-34-3
Sequence	His-Ala-Asp-Ala-Val-Phe-Thr-Ala-Ala-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Ala-Lys-Lys-Ala-Leu-Ala-Ala-Ile-Ala-Ala-NH2
Shortening	HADAVFTAAYARLRKQMAAKKALAAIAA-NH2
Formula	C131H219N41O33S
Molar Mass	2928.46
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Reference	[1]. Hisato Igarashi, et al. Development of simplified vasoactive intestinal peptide analogs with receptor selectivity and stability for human vasoactive intestinal peptide/pituitary adenylate cyclase-activating polypeptide receptors. J Pharmacol Exp Ther. 2005 Oct;315(1):370-81.

PeptideDB