| Bioactivity | [Ala2,8,9,11,19,22,24,25,27,28]-VIP is an analog vasoactive intestinal polypeptide (VIP) with high affinity and selectivity for human VIP/pituitary adenylate cyclase-activating polypeptide 1 (hVPAC1). VIP is a widespread neurotransmitter[1]. |
| CAS | 866552-34-3 |
| Sequence | His-Ala-Asp-Ala-Val-Phe-Thr-Ala-Ala-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Ala-Lys-Lys-Ala-Leu-Ala-Ala-Ile-Ala-Ala-NH2 |
| Shortening | HADAVFTAAYARLRKQMAAKKALAAIAA-NH2 |
| Formula | C131H219N41O33S |
| Molar Mass | 2928.46 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Hisato Igarashi, et al. Development of simplified vasoactive intestinal peptide analogs with receptor selectivity and stability for human vasoactive intestinal peptide/pituitary adenylate cyclase-activating polypeptide receptors. J Pharmacol Exp Ther. 2005 Oct;315(1):370-81. |